NEDD4 Antibody

Images

 
Immunohistochemistry-Paraffin: NEDD4 Antibody [NBP1-83044] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in subsets of neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEDD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLHSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEDD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDD4 Protein (NBP1-83044PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEDD4 Antibody

  • Cell proliferation-inducing gene 53 protein
  • E3 ubiquitin-protein ligase NEDD4
  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0093NEDD4-1MGC176705
  • NEDD4
  • NEDD-4
  • Neural precursor cell expressed developmentally down-regulated protein 4
  • neural precursor cell expressed, developmentally down-regulated 4
  • receptor-potentiating factor 1
  • RPF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54974
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-68142
Species: Hu
Applications: WB, PEP-ELISA
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF8246
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83044
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NEDD4 Antibody (NBP1-83044) (0)

There are no publications for NEDD4 Antibody (NBP1-83044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD4 Antibody (NBP1-83044) (0)

There are no reviews for NEDD4 Antibody (NBP1-83044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEDD4 Antibody (NBP1-83044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEDD4 Products

Bioinformatics Tool for NEDD4 Antibody (NBP1-83044)

Discover related pathways, diseases and genes to NEDD4 Antibody (NBP1-83044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD4 Antibody (NBP1-83044)

Discover more about diseases related to NEDD4 Antibody (NBP1-83044).
 

Pathways for NEDD4 Antibody (NBP1-83044)

View related products by pathway.

PTMs for NEDD4 Antibody (NBP1-83044)

Learn more about PTMs related to NEDD4 Antibody (NBP1-83044).

Blogs on NEDD4

There are no specific blogs for NEDD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD4
Entrez