Nectin-2/CD112 Recombinant Protein Antigen

Images

 
There are currently no images for Nectin-2/CD112 Protein (NBP1-91211PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nectin-2/CD112 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVRL2.

Source: E. coli

Amino Acid Sequence: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NECTIN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91211.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nectin-2/CD112 Recombinant Protein Antigen

  • CD112 antigen
  • CD112
  • Herpes virus entry mediator B
  • Herpesvirus entry mediator B
  • herpesvirus entry protein B
  • HVEB
  • HVEBpoliovirus receptor-like 2
  • MPH
  • nectin 2
  • Nectin2
  • Nectin-2
  • poliovirus receptor-related 2 (herpesvirus entry mediator B)
  • poliovirus receptor-related protein 2
  • PRR2
  • PRR2nectin-2
  • PVRL2
  • PVRR2poliovirus receptor related 2

Background

Nectin 2 encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
MAB666
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
MAB356
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF3064
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NB100-2421
Species: Hu
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NB300-186
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
1849-NK
Species: Hu
Applications: BA
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF2225
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB

Publications for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no publications for Nectin-2/CD112 Protein (NBP1-91211PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no reviews for Nectin-2/CD112 Protein (NBP1-91211PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nectin-2/CD112 Protein (NBP1-91211PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nectin-2/CD112 Products

Research Areas for Nectin-2/CD112 Protein (NBP1-91211PEP)

Find related products by research area.

Blogs on Nectin-2/CD112

There are no specific blogs for Nectin-2/CD112, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nectin-2/CD112 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NECTIN2