NECAB3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NECAB3 Antibody [NBP2-55136] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NECAB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNN
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NECAB3 Recombinant Protein Antigen (NBP2-55136PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NECAB3 Antibody - BSA Free

• Amyloid beta A4 protein-binding family A member 2-binding protein
• APBA2BPfamily A, member 2 binding protein
• dJ63M2.4
• dJ63M2.5
• EFCBP3STIP3
• EF-hand calcium binding protein 3
• Neuronal calcium-binding protein 3
• neuronal calcium-binding protein NECAB3
• NIP1Nek2-interacting protein 1
• N-terminal EF-hand calcium binding protein 3
• N-terminal EF-hand calcium-binding protein 3
• synaptotagmin interacting protein 2
• synaptotagmin interacting protein STIP3
• SYTIP2
• XB51X11L-binding protein 51

Background

NECAB3 is encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NECAB3