Recombinant Human NDUFV1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NDUFV1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 365-464 of Human NDUFV1

Source: Wheat Germ

Amino Acid Sequence: KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NDUFV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFV1 Protein

  • CI-51K
  • CI51KD
  • CI-51kD
  • complex I 51kDa subunit
  • complex I, mitochondrial respiratory chain
  • Complex I-51kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • FLJ59059
  • mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
  • NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
  • NADH dehydrogenase flavoprotein 1
  • NADH-ubiquinone oxidoreductase 51 kDa subunit
  • UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Background

NDUFV1 - NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89026
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00374291-P01
Species: Hu
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59598
Species: Hu
Applications: WB
AF3014
Species: Hu
Applications: WB, IHC, Block
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NBP1-82662
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004723-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NDUFV1 Partial Recombinant Protein (H00004723-Q01) (0)

There are no publications for NDUFV1 Partial Recombinant Protein (H00004723-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV1 Partial Recombinant Protein (H00004723-Q01) (0)

There are no reviews for NDUFV1 Partial Recombinant Protein (H00004723-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV1 Partial Recombinant Protein (H00004723-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFV1 Products

Bioinformatics Tool for NDUFV1 Partial Recombinant Protein (H00004723-Q01)

Discover related pathways, diseases and genes to NDUFV1 Partial Recombinant Protein (H00004723-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV1 Partial Recombinant Protein (H00004723-Q01)

Discover more about diseases related to NDUFV1 Partial Recombinant Protein (H00004723-Q01).
 

Pathways for NDUFV1 Partial Recombinant Protein (H00004723-Q01)

View related products by pathway.

PTMs for NDUFV1 Partial Recombinant Protein (H00004723-Q01)

Learn more about PTMs related to NDUFV1 Partial Recombinant Protein (H00004723-Q01).

Blogs on NDUFV1

There are no specific blogs for NDUFV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDUFV1 Antibody (4A7)
H00004723-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFV1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV1