NDUFV1 Antibody

Immunocytochemistry/Immunofluorescence: NDUFV1 Antibody [NBP2-57926] - Staining of human cell line SK-MEL-30 shows localization to cytosol & mitochondria.

Product Discontinued

NDUFV1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFV1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFV1 Antibody

• CI-51K
• CI51KD
• CI-51kD
• complex I 51kDa subunit
• complex I, mitochondrial respiratory chain
• Complex I-51kD
• EC 1.6.5.3
• EC 1.6.99.3
• EC 1.6.99.5
• FLJ59059
• mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
• NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
• NADH dehydrogenase flavoprotein 1
• NADH-ubiquinone oxidoreductase 51 kDa subunit
• UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Background

The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV1