Ndufs4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ndufs4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ndufs4 Antibody - BSA Free (NBP1-89026) is a polyclonal antibody validated for use in IHC. Anti-Ndufs4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVS
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFS4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ndufs4 Protein (NBP1-89026PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ndufs4 Antibody - BSA Free

• AQDQ
• AQDQmitochondrial
• CI-18 kDa
• NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18kD) (NADH-coenzyme Qreductase)
• NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Qreductase)
• NADH-coenzyme Q reductase, 18-KD
• NADH-ubiquinone oxidoreductase 18 kDa subunit

Background

Ndufs4 encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ndufs4 Antibody (NBP1-89026)(1)

Publication using NBP1-89026

• Papadaki V, Erpapazoglou Z, Kokkori M et al. IQGAP1 mediates the communication between the nucleus and the mitochondria via NDUFS4 alternative splicing NAR Cancer 2023-08-24 [PMID: 37636315]

Bioinformatics

• Gene Symbol: NDUFS4