Ndufs4 Antibody

Images

 
Genetic Strategies: Western Blot: Ndufs4 Antibody [NBP1-89026] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Ndufs4 Antibody [NBP1-89026] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: Ndufs4 Antibody [NBP1-89026] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Ndufs4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ndufs4 Protein (NBP1-89026PEP)
Publications
Read Publication using NBP1-89026.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ndufs4 Antibody

  • AQDQ
  • AQDQmitochondrial
  • CI-18 kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Qreductase)
  • NADH-coenzyme Q reductase, 18-KD
  • NADH-ubiquinone oxidoreductase 18 kDa subunit

Background

Ndufs4 encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-33074
Species: Hu, Mu, Ze
Applications: IHC, IHC-P, KO, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46127
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP1-49846
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-49127
Species: Hu
Applications: IHC, IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84475
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00004722-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, WB
NBP2-47359
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-118
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88937
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Ndufs4 Antibody (NBP1-89026)(1)

Reviews for Ndufs4 Antibody (NBP1-89026) (0)

There are no reviews for Ndufs4 Antibody (NBP1-89026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ndufs4 Antibody (NBP1-89026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ndufs4 Products

Diseases for Ndufs4 Antibody (NBP1-89026)

Discover more about diseases related to Ndufs4 Antibody (NBP1-89026).
 

Pathways for Ndufs4 Antibody (NBP1-89026)

View related products by pathway.

PTMs for Ndufs4 Antibody (NBP1-89026)

Learn more about PTMs related to Ndufs4 Antibody (NBP1-89026).
 

Research Areas for Ndufs4 Antibody (NBP1-89026)

Find related products by research area.

Blogs on Ndufs4

There are no specific blogs for Ndufs4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ndufs4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS4