Home » NDUFB7 » NDUFB7 Antibodies » NDUFB7 Antibody (4D4)

NDUFB7 Antibody (4D4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.Lane 1: NDUFB7 transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.Lane 1: NDUFB7 transfected lysate(16.4 KDa).Lane 2: ...read more
Genetic Strategies: Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi ( Cat # H00004713-R01V ) (Lane 2) or ...read more
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - NDUFB7 monoclonal antibody (M01), clone 4D4 Analysis of NDUFB7 expression in A-431.
ELISA: NDUFB7 Antibody (4D4) [H00004713-M01] - Detection limit for recombinant GST tagged NDUFB7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

NDUFB7 Antibody (4D4) Summary

Immunogen
NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Specificity
NDUFB7 (4D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFB7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB7 Antibody (4D4)

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDUFA2 Antibody
NBP2-93743
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFA2 Antibody [NBP2-93743] - Paraffin-embedded human liver cancer using NDUFA2.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
HLA B Antibody
(2G7B10)
NBP2-61871
Western Blot: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis using HLA-B mAb against HEK293 (1) and HLA-B (AA: 241-362)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of bladder cancer tissues using HLA-B mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
DR3/TNFRSF25
Antibody (59204) [Unc ...
MAB943
Mouse splenocytes either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B) and Rat Anti-Mouse CD3 PE‑conjugated Monoclonal Antibody (Catalog # FAB4841P). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Human peripheral blood mononuclear cells (PBMCs) either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B) and Mouse Anti-Human CD3 epsilon APC‑conjugated Monoclonal Antibody (Catalog # FAB100A). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Western blot shows lysates of human CD8+ T cells. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for DR3/TNFRSF25 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
HLA DRB4 Antibody
(4C8)
H00003126-M01
Western Blot: HLA DRB4 Antibody (4C8) [H00003126-M01] - HLA-DRB4 monoclonal antibody (M01), clone 4C8. Analysis of HLA-DRB4 expression in human kidney.
Immunohistochemistry-Paraffin: HLA DRB4 Antibody (4C8) [H00003126-M01] - Analysis of monoclonal antibody to HLA-DRB4 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Sandwich ELISA: HLA DRB4 Antibody (4C8) [H00003126-M01] - Detection limit for recombinant GST tagged HLA-DRB4 is approximately 1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Human Complement
Component C2 ELISA Ki ...
NBP2-60548
ELISA: Human Complement Component C2 ELISA Kit (Colorimetric) [NBP2-60548] - Standard curve.
Species: Hu
HLA ABC Antibody
(W6/32)
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC.
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488.
(1 Review)
(24 Publications)
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Western Blot: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of alpha sarcoglycan on rat heart tissue lysates using anti-alpha sarcoglycan antibody at 1:500 dilution.
Immunohistochemistry-Frozen: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse heart tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
GPHA2 Antibody
NBP3-04883
Western Blot: GPHA2 Antibody [NBP3-04883] - Analysis of extracts of rat brain, using GPHA2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit.
Species: Hu, Mu, Rt
Applications: WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NDUFB4 Antibody
NBP2-33626
Western Blot: NDUFB4 Antibody [NBP2-33626] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP2-33626] - Staining of human cell line U-2 OS shows localization to nuclear membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TRAILR1/TNFRSF10A
Antibody [Unconjugate ...
AF347
Western blot shows lysates of TF‑1 human erythroleukemic cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRAIL R1/TNFRSF10A at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions.
In the presence of a cross-linking antibody, Mouse polyHistidine Monoclonal Antibody (Catalog # MAB050) and the metabolic inhibitor actinomycin D (1 µg/mL), Recombinant Human TRAIL R1/TNFRSF10A Fc Chimera (Catalog # 347‑DR) inhibits Recombinant Human TRAIL/TNFSF10 (Catalog # 375‑TL) induced cytotoxicity in the L‑929 mouse fibroblast cell line in a dose-dependent manner (orange line), as measured by crystal violet staining. Under these conditions, inhibition of Recombinant Human TRAIL/TNFSF10 (12 ng/mL) activity elicited by Recombinant Human TRAIL R1/TNFRSF10A Fc Chimera (10 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347). The ND50 is typically 0.02‑0.055 µg/mL.
TRAIL R1/TNFRSF10A was detected in immersion fixed paraffin-embedded sections of human brain using Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(31 Publications)
Species: Hu
Applications: WB, IHC, Neut
Complement Factor
B Antibody
NBP1-89985
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
B7-1/CD80 Antibody
(62N3G8)
NBP2-25255
Western Blot: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Analysis in human Raji lymphoma cells.
Immunohistochemistry-Paraffin: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Human thymus stained with CD80 antibody at 5 ug/ml using peroxidase-conjugate and DAB chromogen. Note membrane and cytoplasmic staining.
Flow Cytometry: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Raji lymphoma cells. Image from verified customer review.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
EIF3M Antibody
NBP1-83552
Western Blot: EIF3M Antibody [NBP1-83552] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: EIF3M Antibody [NBP1-83552] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-83552] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
STT3A Antibody
(4D4)
H00003703-M02
Western Blot: STT3A Antibody (4D4) [H00003703-M02] - Analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: STT3A Antibody (4D4) [H00003703-M02] - Analysis of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: STT3A Antibody (4D4) [H00003703-M02] - Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Human prostate tissue.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB

Publications for NDUFB7 Antibody (H00004713-M01) (0)

There are no publications for NDUFB7 Antibody (H00004713-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (H00004713-M01) (0)

There are no reviews for NDUFB7 Antibody (H00004713-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB7 Antibody (H00004713-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NDUFB7 Products

Bioinformatics Tool for NDUFB7 Antibody (H00004713-M01)

Discover related pathways, diseases and genes to NDUFB7 Antibody (H00004713-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB7 Antibody (H00004713-M01)

Discover more about diseases related to NDUFB7 Antibody (H00004713-M01).
 

Pathways for NDUFB7 Antibody (H00004713-M01)

View related products by pathway.

PTMs for NDUFB7 Antibody (H00004713-M01)

Learn more about PTMs related to NDUFB7 Antibody (H00004713-M01).
 

Research Areas for NDUFB7 Antibody (H00004713-M01)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody (4D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFB7
Entrez
OMIM
Uniprot