Home » NDUFB7 » NDUFB7 Antibodies » NDUFB7 Antibody (4D4)

NDUFB7 Antibody (4D4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.Lane 1: NDUFB7 transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.Lane 1: NDUFB7 transfected lysate(16.4 KDa).Lane 2: ...read more
Genetic Strategies: Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi ( Cat # H00004713-R01V ) (Lane 2) or ...read more
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - NDUFB7 monoclonal antibody (M01), clone 4D4 Analysis of NDUFB7 expression in A-431.
ELISA: NDUFB7 Antibody (4D4) [H00004713-M01] - Detection limit for recombinant GST tagged NDUFB7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

NDUFB7 Antibody (4D4) Summary

Immunogen
NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Specificity
NDUFB7 (4D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFB7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB7 Antibody (4D4)

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDUFA2 Antibody
NBP2-93743
Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA: HLA B Antibody (2G7B10) [NBP2-61871] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of MCF-7 cells using HLA-B mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Complement C4a/b
Antibody (JM88-13)
NBP2-66995
Immunocytochemistry/Immunofluorescence: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Staining C4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Analysis of paraffin-embedded human liver cancer tissue using anti-C4 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Complement C4a/b Antibody (JM88-13) [NBP2-66995] - Analysis of paraffin-embedded human liver tissue using anti-C4 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DR3/TNFRSF25
Antibody (59204) [Unc ...
MAB943
Mouse splenocytes either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B) and Rat Anti-Mouse CD3 PE‑conjugated Monoclonal Antibody (Catalog # FAB4841P). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Human peripheral blood mononuclear cells (PBMCs) either (A) untreated or (B) treated with PMA and Calcium Ionomycin for 24 hours were stained with Mouse Anti-Human DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B) and Mouse Anti-Human CD3 epsilon APC‑conjugated Monoclonal Antibody (Catalog # FAB100A). Quadrant markers were set based on control antibody staining (Catalog # MAB002).
Western blot shows lysates of human CD8+ T cells. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse DR3/TNFRSF25 Monoclonal Antibody (Catalog # MAB943) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for DR3/TNFRSF25 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(4 Reviews)
(1 Publication)
Species: Hu
Applications: IP, WB
HLA ABC Antibody
(W6/32) - Azide and B ...
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the PE/Cy5 conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control PE-Cy5 (NBP1-43073) (blue histogram) or Anti-Human HLA-ABC PE-Cy5 (purple histogram). Cells in the lymphocyte gate were
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Immunohistochemistry-Frozen: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis of Mouse colon cancer tissue using HLA ABC antibody (W6/32). Primary antibody dilution was 1:100. Sample was incubated with secondary antibody in 1:300 dilution. Image from verified customer review.
(2 Reviews)
(27 Publications)
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse heart tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
Immunohistochemistry-Frozen: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
GPHA2 Antibody
NBP3-17255
Western Blot: GPHA2 Antibody [NBP3-17255] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/Immunofluorescence: GPHA2 Antibody [NBP3-17255] - Staining of human cell line Hep G2 shows localization to vesicles.
Species: Hu
Applications: ICC/IF, WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry-Paraffin: ATP6V0A2 Antibody [NBP1-59069] - overexpressed mouse sequences tissue
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NDUFB4 Antibody
NBP2-33626
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining in human heart muscle and pancreas tissues using anti-NDUFB4 antibody. Corresponding NDUFB4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP2-33626] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TRAILR1/TNFRSF10A
Antibody [Unconjugate ...
AF347
In the presence of a cross-linking antibody, Mouse polyHistidine Monoclonal Antibody (Catalog # MAB050) and the metabolic inhibitor actinomycin D (1 µg/mL), Recombinant Human TRAIL R1/TNFRSF10A Fc Chimera (Catalog # 347‑DR) inhibits Recombinant Human TRAIL/TNFSF10 (Catalog # 375‑TL) induced cytotoxicity in the L‑929 mouse fibroblast cell line in a dose-dependent manner (orange line), as measured by crystal violet staining. Under these conditions, inhibition of Recombinant Human TRAIL/TNFSF10 (12 ng/mL) activity elicited by Recombinant Human TRAIL R1/TNFRSF10A Fc Chimera (10 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347). The ND50 is typically 0.02‑0.055 µg/mL.
Western blot shows lysates of TF‑1 human erythroleukemic cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRAIL R1/TNFRSF10A at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions.
TRAIL R1/TNFRSF10A was detected in immersion fixed paraffin-embedded sections of human brain using Goat Anti-Human TRAIL R1/TNFRSF10A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF347) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(34 Publications)
Species: Hu
Applications: IHC, Neut, WB
Complement Factor
B Antibody
NBP1-89985
Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Raji human Burkitt's lymphoma cell line was stained with Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Fluorescein-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0103B). View our protocol for Staining Membrane-associated Proteins.
B7‑1/CD80 was detected in immersion fixed paraffin-embedded sections of human tonsil using Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
B7-1/CD80 mRNA was detected in formalin-fixed paraffin-embedded tissue sections of human tonsil probed with ACD RNAScope® Probe (Catalog # 42471) and stained using ACD RNAscope® 2.5 HD Duplex Detection Reagents (red, Catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Mouse Anti-Human B7-1/CD80 Monoclonal Antibody (Catalog# MAB140) at 5ug/mL with overnight incubation at 4 °C followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (R&D Systems,  Catalog # VC001) and DAB chromogen (lower image, brown). Tissues were counterstained with hematoxylin (blue).
(1 Review)
(12 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
EIF3M Antibody
NBP1-83552
Western Blot: EIF3M Antibody [NBP1-83552] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-83552] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunocytochemistry/Immunofluorescence: EIF3M Antibody [NBP1-83552] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
STT3A Antibody
(4D4)
H00003703-M02
Western Blot: STT3A Antibody (4D4) [H00003703-M02] - Analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: STT3A Antibody (4D4) [H00003703-M02] - Analysis of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: STT3A Antibody (4D4) [H00003703-M02] - Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Adenocarcinoma of Human endometrium tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB

Publications for NDUFB7 Antibody (H00004713-M01) (0)

There are no publications for NDUFB7 Antibody (H00004713-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (H00004713-M01) (0)

There are no reviews for NDUFB7 Antibody (H00004713-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB7 Antibody (H00004713-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB7 Products

Bioinformatics Tool for NDUFB7 Antibody (H00004713-M01)

Discover related pathways, diseases and genes to NDUFB7 Antibody (H00004713-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB7 Antibody (H00004713-M01)

Discover more about diseases related to NDUFB7 Antibody (H00004713-M01).
 

Pathways for NDUFB7 Antibody (H00004713-M01)

View related products by pathway.

PTMs for NDUFB7 Antibody (H00004713-M01)

Learn more about PTMs related to NDUFB7 Antibody (H00004713-M01).
 

Research Areas for NDUFB7 Antibody (H00004713-M01)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody (4D4) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFB7
Entrez
OMIM
Uniprot