NDUFB7 Antibody (4D4)

Images

 
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody (M01), clone 4D4.Lane 1: NDUFB7 transfected lysate(16.4 KDa).Lane 2: ...read more
Genetic Strategies: Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - Analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi ( Cat # H00004713-R01V ) (Lane 2) or ...read more
Western Blot: NDUFB7 Antibody (4D4) [H00004713-M01] - NDUFB7 monoclonal antibody (M01), clone 4D4 Analysis of NDUFB7 expression in A-431.
ELISA: NDUFB7 Antibody (4D4) [H00004713-M01] - Detection limit for recombinant GST tagged NDUFB7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

NDUFB7 Antibody (4D4) Summary

Immunogen
NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Specificity
NDUFB7 (4D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFB7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB7 Antibody (4D4)

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB

Publications for NDUFB7 Antibody (H00004713-M01) (0)

There are no publications for NDUFB7 Antibody (H00004713-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (H00004713-M01) (0)

There are no reviews for NDUFB7 Antibody (H00004713-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB7 Antibody (H00004713-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFB7 Products

Bioinformatics Tool for NDUFB7 Antibody (H00004713-M01)

Discover related pathways, diseases and genes to NDUFB7 Antibody (H00004713-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB7 Antibody (H00004713-M01)

Discover more about diseases related to NDUFB7 Antibody (H00004713-M01).
 

Pathways for NDUFB7 Antibody (H00004713-M01)

View related products by pathway.

PTMs for NDUFB7 Antibody (H00004713-M01)

Learn more about PTMs related to NDUFB7 Antibody (H00004713-M01).
 

Research Areas for NDUFB7 Antibody (H00004713-M01)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody (4D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB7
Entrez
OMIM
Uniprot