NDUFB5 Antibody

Images

 
Western Blot: NDUFB5 Antibody [NBP1-85607] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: NDUFB5 Antibody [NBP1-85607] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

NDUFB5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NDUFB5 Protein (NBP1-85607PEP)

Alternate Names for NDUFB5 Antibody

  • 5 (16kD, SGDH)
  • CISGDH
  • CI-SGDH
  • Complex I-SGDH
  • DKFZp686N02262
  • FLJ30597
  • MGC111204
  • MGC12314
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  • SGDH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4647
Species: Hu
Applications: WB, IHC, IP
NBP1-80860
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00000518-P01
Species: Hu
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92036
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004723-M01
Species: Hu
Applications: WB, ELISA

Publications for NDUFB5 Antibody (NBP1-85607) (0)

There are no publications for NDUFB5 Antibody (NBP1-85607).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB5 Antibody (NBP1-85607) (0)

There are no reviews for NDUFB5 Antibody (NBP1-85607). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB5 Antibody (NBP1-85607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB5 Antibody Products

Related Products by Gene

Bioinformatics Tool for NDUFB5 Antibody (NBP1-85607)

Discover related pathways, diseases and genes to NDUFB5 Antibody (NBP1-85607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB5 Antibody (NBP1-85607)

Discover more about diseases related to NDUFB5 Antibody (NBP1-85607).
 

Pathways for NDUFB5 Antibody (NBP1-85607)

View related products by pathway.

Blogs on NDUFB5

There are no specific blogs for NDUFB5, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NDUFB5

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-85607 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought