NDUFB5 Antibody - BSA Free

Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining in human heart muscle and pancreas tissues.. Corresponding NDUFB5 RNA-seq data are presented for the same tissues.

Western Blot: NDUFB5 Antibody [NBP1-85607] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: NDUFB5 Antibody [NBP1-85607] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Frozen: NDUFB5 Antibody [NBP1-85607] - PFA-fixed cryosections (14 um) of adult mouse brain.100x confocal imaging. Mitochondria are labeled. Antigen retrieval was performed in boiling 10mM citric acid (pH6) for 15 min, followed by block in 5% goat serum (PBS/ 0.3% triton) and incubated in primary ab (1:100) overnight at 4C in goat block. Developed with goat-anti-rabbit Alexa 488. Image from verified customer review.

Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.

Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human pancreas shows weak positivity in mitochondria in exocrine glandular cells.

Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB5 Antibody - BSA Free (NBP1-85607) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. NDUFB5 antibody validated for IHC-FR from a verified customer review.
• Control Peptide:

  NDUFB5 Protein (NBP1-85607PEP)

Reactivity Notes

Reactivity reported in adult mouse brain from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFB5 Antibody - BSA Free

• 5 (16kD, SGDH)
• CISGDH
• CI-SGDH
• Complex I-SGDH
• DKFZp686N02262
• FLJ30597
• MGC111204
• MGC12314
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
• SGDH

Background

NDUFB5 is encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for NDUFB5 Antibody (NBP1-85607) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-Fr Mouse 07/10/2018

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: PFA-fixed cryosections of mouse brain
• Species: Mouse
• Lot: a116896

Comments

• Comments: This tissue was fixed in 4% PFA, and cryosectioned. Antigen retrieval was performed in boiling 10mM citric acid (pH6) for 15 min, followed by block in 5% goat serum (PBS/ 0.3% triton) and incubated in primary ab (1:100) overnight at 4C in goat block. Developed with goat-anti-rabbit Alexa 488.

Bioinformatics

• Gene Symbol: NDUFB5