NDUFB5 Antibody

Images

 
Western Blot: NDUFB5 Antibody [NBP1-85607] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: NDUFB5 Antibody [NBP1-85607] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Frozen: NDUFB5 Antibody [NBP1-85607] - PFA-fixed cryosections (14 um) of adult mouse brain.100x confocal imaging. Mitochondria are labeled. Antigen retrieval was performed in boiling 10mM citric ...read more
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining in human heart muscle and pancreas tissues using anti-NDUFB5 antibody. Corresponding NDUFB5 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining in human heart muscle and pancreas tissues.. Corresponding NDUFB5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human pancreas shows weak positivity in mitochondria in exocrine glandular cells.
Immunohistochemistry-Paraffin: NDUFB5 Antibody [NBP1-85607] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NDUFB5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Specificity
Specificity of human NDUFB5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFB5 Protein (NBP1-85607PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85607 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFB5 Antibody

  • 5 (16kD, SGDH)
  • CISGDH
  • CI-SGDH
  • Complex I-SGDH
  • DKFZp686N02262
  • FLJ30597
  • MGC111204
  • MGC12314
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  • SGDH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-38249
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4647
Species: Hu
Applications: WB, IHC, IP
NBP1-80860
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-65538
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-80324
Species: Hu
Applications: WB
NBP1-33074
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85607
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for NDUFB5 Antibody (NBP1-85607) (0)

There are no publications for NDUFB5 Antibody (NBP1-85607).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for NDUFB5 Antibody (NBP1-85607) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-85607:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen NDUFB5 NBP1-85607
Enlarge
reviewed by:
Anonymous
IHC-Fr Mouse 07/10/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedPFA-fixed cryosections of mouse brain
SpeciesMouse
Lota116896

Comments

CommentsThis tissue was fixed in 4% PFA, and cryosectioned. Antigen retrieval was performed in boiling 10mM citric acid (pH6) for 15 min, followed by block in 5% goat serum (PBS/ 0.3% triton) and incubated in primary ab (1:100) overnight at 4C in goat block. Developed with goat-anti-rabbit Alexa 488.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB5 Antibody (NBP1-85607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFB5 Antibody (NBP1-85607)

Discover related pathways, diseases and genes to NDUFB5 Antibody (NBP1-85607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB5 Antibody (NBP1-85607)

Discover more about diseases related to NDUFB5 Antibody (NBP1-85607).
 

Pathways for NDUFB5 Antibody (NBP1-85607)

View related products by pathway.

Blogs on NDUFB5

There are no specific blogs for NDUFB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
07/10/2018
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol NDUFB5