NDUFB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NDUFB2 Antibody [NBP2-31908] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB2 Antibody - BSA Free (NBP2-31908) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDUFB2 Protein (NBP2-31908PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFB2 Antibody - BSA Free

• CI-AGGGmitochondrial
• MGC70788
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 (8kD, AGGG)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa

Background

The protein encoded by the NDUFB2 gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFB2
• Uniprot:
  • O95178(Human)