NDUFB1 Antibody - Azide and BSA Free

Western Blot: NDUFB1 Antibody [NBP3-15500] - Western blot analysis of extracts of various cell lines, using NDUFB1 antibody (NBP3-15500) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: NDUFB1 Antibody - Azide and BSA Free [NBP3-15500] - Immunofluorescence analysis of L929 cells using NDUFB1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFB1 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human NDUFB1 (NP_004536.2). MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NDUFB1 Antibody - Azide and BSA Free

• CI-MNLLCI-SGDH
• complex I MNLL subunit
• Complex I-MNLL
• MNLL
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (7kD, MNLL)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
• NADH-ubiquinone oxidoreductase MNLL subunit

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NDUFB1