NDUFA8 Antibody (2E10)

Images

 
Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody (M05), clone 2E10. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1 ...read more
Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml
Sandwich ELISA: NDUFA8 Antibody (2E10) [H00004702-M05] - Detection limit for recombinant GST tagged NDUFA8 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFA8 Antibody (2E10) Summary

Immunogen
NDUFA8 (NP_055037.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Specificity
Reacts with NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFA8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA8 Antibody (2E10)

  • CI-19KD
  • CI-PGIV
  • complex I PGIV subunit
  • Complex I-19kD
  • Complex I-PGIV
  • MGC793
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  • NADH:ubiquinone oxidoreductase PGIV subunit
  • NADH-ubiquinone oxidoreductase 19 kDa subunit
  • PGIV

Background

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49846
Species: Hu
Applications: WB, PEP-ELISA
NBP1-56520
Species: Hu, Mu, Rt
Applications: WB
NBP1-33074
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KO
NBP1-91011
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF3014
Species: Hu
Applications: WB, IHC, Block
H00004696-P01
Species: Hu
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-19506
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFA8 Antibody (H00004702-M05) (0)

There are no publications for NDUFA8 Antibody (H00004702-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA8 Antibody (H00004702-M05) (0)

There are no reviews for NDUFA8 Antibody (H00004702-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA8 Antibody (H00004702-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFA8 Products

Bioinformatics Tool for NDUFA8 Antibody (H00004702-M05)

Discover related pathways, diseases and genes to NDUFA8 Antibody (H00004702-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA8 Antibody (H00004702-M05)

Discover more about diseases related to NDUFA8 Antibody (H00004702-M05).
 

Pathways for NDUFA8 Antibody (H00004702-M05)

View related products by pathway.

PTMs for NDUFA8 Antibody (H00004702-M05)

Learn more about PTMs related to NDUFA8 Antibody (H00004702-M05).

Blogs on NDUFA8

There are no specific blogs for NDUFA8, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA8 Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA8
Entrez
Uniprot
COVID-19 update