NDUFA8 Antibody (2E10) - Azide and BSA Free

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody (M05), clone 2E10. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml

Sandwich ELISA: NDUFA8 Antibody (2E10) [H00004702-M05] - Detection limit for recombinant GST tagged NDUFA8 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 2E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFA8 Antibody (2E10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NDUFA8 (NP_055037.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
• Specificity: Reacts with NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NDUFA8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA8 Antibody (2E10) - Azide and BSA Free

• CI-19KD
• CI-PGIV
• complex I PGIV subunit
• Complex I-19kD
• Complex I-PGIV
• MGC793
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
• NADH:ubiquinone oxidoreductase PGIV subunit
• NADH-ubiquinone oxidoreductase 19 kDa subunit
• PGIV

Background

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA8
• Entrez:
  • 4702(Human)
• Uniprot:
  • NP_055037(Human)