NDUFA4 Antibody - Azide and BSA Free

Western Blot: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] - Western blot analysis of lysates from U-251 MG cells using NDUFA4 Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: NDUFA4 Antibody - Azide and BSA Free [NBP2-93390] - Immunohistochemistry analysis of paraffin-embedded human liver using NDUFA4 Rabbit pAb at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFA4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA4 Antibody - Azide and BSA Free (NBP2-93390) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1). MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:100 - 1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NDUFA4 Antibody - Azide and BSA Free

• CI-9k
• CI-MLRQ
• Complex I 9kDa subunit
• Complex I-MLRQ
• FLJ27440
• MGC104422
• MGC126843
• MGC126845
• MLRQ
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4
• NADH-ubiquinone oxidoreductase MLRQ subunit

Background

NDUFA4 is encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Review for NDUFA4 Antibody (NBP2-93390) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer Simple Western Human 04/06/2023

Summary

• Application: Simple Western
• Sample Tested: human brain lysate
• Species: Human
• Lot: 0118010201

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: NDUFA4