We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human NDUFA1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human NDUFA1 Protein [H00004694-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human NDUFA1 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-70 of Human NDUFA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NDUFA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
33.44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFA1 GST (N-Term) Protein

  • CI-MWFEcomplex I MWFE subunit
  • Complex I-MWFE
  • MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
  • NADH oxidoreductase subunit MWFE
  • NADH:ubiquinone oxidoreductase (complex 1)
  • NADH-ubiquinone oxidoreductase MWFE subunit
  • type I dehydrogenase
  • ZNF183

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-97854
Species: Pm-Cm, Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-29103
Species: Hu
Applications: IHC, IP, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
QET00B
Species: Hu
Applications: ELISA
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88937
Species: Hu
Applications: IHC,  IHC-P
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-37940
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88934
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32304
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, KO, WB
NBP2-47365
Species: Hu
Applications: IHC,  IHC-P
NBP2-94462
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93986
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for NDUFA1 Recombinant Protein (H00004694-P02) (0)

There are no publications for NDUFA1 Recombinant Protein (H00004694-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA1 Recombinant Protein (H00004694-P02) (0)

There are no reviews for NDUFA1 Recombinant Protein (H00004694-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA1 Recombinant Protein (H00004694-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA1 Products

Blogs on NDUFA1.

Mechanisms of Neurodegeneration: Mitochondrial Dysfunction and Oxidative Stress
By Michalina Hanzel, PhDIn this second installment of our three blog-posts series on major cellular mechanisms responsible for neurodegenerative disorders, we will explore the processes of mitochondrial dysfunction an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA1