NDUFA1 Recombinant Protein Antigen

Images

 
There are currently no images for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NDUFA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFA1.

Source: E. coli

Amino Acid Sequence: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NDUFA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NDUFA1 Recombinant Protein Antigen

  • CI-MWFEcomplex I MWFE subunit
  • Complex I-MWFE
  • MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
  • NADH oxidoreductase subunit MWFE
  • NADH:ubiquinone oxidoreductase (complex 1)
  • NADH-ubiquinone oxidoreductase MWFE subunit
  • type I dehydrogenase
  • ZNF183

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12681
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NBP1-89026
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94617
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-29103
Species: Hu
Applications: IHC, IP, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
QET00B
Species: Hu
Applications: ELISA
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88937
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-37940
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3357
Species: Mu
Applications: WB
NBP1-32304
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, KO, WB
NBP2-47365
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94462
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-93986
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP) (0)

There are no publications for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP) (0)

There are no reviews for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NDUFA1 Recombinant Protein Antigen (NBP2-49127PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA1 Products

Blogs on NDUFA1.

Mechanisms of Neurodegeneration: Mitochondrial Dysfunction and Oxidative Stress
By Michalina Hanzel, PhDIn this second installment of our three blog-posts series on major cellular mechanisms responsible for neurodegenerative disorders, we will explore the processes of mitochondrial dysfunction an...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NDUFA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA1