NDUFA1 Antibody [DyLight 594]

Product Discontinued

NDUFA1 Antibody [DyLight 594] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NDUFA1 (NP_004532.1).
  
  Sequence:
  MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for NDUFA1 Antibody [DyLight 594]

• CI-MWFEcomplex I MWFE subunit
• Complex I-MWFE
• MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• NADH oxidoreductase subunit MWFE
• NADH:ubiquinone oxidoreductase (complex 1)
• NADH-ubiquinone oxidoreductase MWFE subunit
• type I dehydrogenase
• ZNF183

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA1