NDNL2 Antibody

Images

 
Western Blot: NDNL2 Antibody [NBP1-79687] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDNL2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human NDNL2The immunogen for this antibody is NDNL2. Peptide sequence IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Equine (100%), Guinea Pig (100%), Bovine (93%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDNL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against NDNL2 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NDNL2 Antibody

  • HCA4hepatocellular carcinoma-associated protein HCA4
  • Hepatocellular carcinoma-associated protein 4
  • MAGEG1MAGE-G1 antigen
  • MAGEL3
  • melanoma antigen, family G, 1
  • melanoma-associated antigen G1
  • necdin-like 2
  • necdin-like gene 2
  • Necdin-like protein 2
  • NSE3
  • NSMCE3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-32455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92200
Species: Hu
Applications: IHC, IHC-P
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73070
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP2-48653
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00004692-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
AF2030
Species: Hu
Applications: WB, IHC
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94096
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079677-M01
Species: Hu
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP, S-ELISA
NBP2-38048
Species: Hu
Applications: IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-79687
Species: Hu, Mu, Rt, Bv, Eq, Gp, Rb
Applications: WB

Publications for NDNL2 Antibody (NBP1-79687) (0)

There are no publications for NDNL2 Antibody (NBP1-79687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDNL2 Antibody (NBP1-79687) (0)

There are no reviews for NDNL2 Antibody (NBP1-79687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDNL2 Antibody (NBP1-79687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDNL2 Products

Array NBP1-79687

Bioinformatics Tool for NDNL2 Antibody (NBP1-79687)

Discover related pathways, diseases and genes to NDNL2 Antibody (NBP1-79687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDNL2 Antibody (NBP1-79687)

Discover more about diseases related to NDNL2 Antibody (NBP1-79687).
 

Pathways for NDNL2 Antibody (NBP1-79687)

View related products by pathway.

Blogs on NDNL2

There are no specific blogs for NDNL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDNL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDNL2
Uniprot