NDFIP2 Antibody - Azide and BSA Free

Western Blot: NDFIP2 Antibody [H00054602-B02P] - Analysis of NDFIP2 expression in transfected 293T cell line by NDFIP2 polyclonal antibody. Lane 1: NDFIP2 transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDFIP2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NDFIP2 Antibody - Azide and BSA Free (H00054602-B02P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NDFIP2 (AAH26126.1, 1 a.a. - 242 a.a.) full-length human protein. MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAVSSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
• Specificity: NDFIP2 - Nedd4 family interacting protein 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NDFIP2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDFIP2 Antibody - Azide and BSA Free

• FLJ25842
• KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07
• MAPK-activating protein PM04 PM05 PM06 PM07
• N4wbp5a
• Nedd4 family interacting protein 2
• NEDD4 family-interacting protein 2
• NEDD4 WW domain-binding protein 5A
• NF-kappa-B-activating protein 413
• Putative NF-kappa-B-activating protein 413

Background

NDFIP2, also known as NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, putative MAPK-activating protein PM04/PM05/PM06/PM07 and putative NF-kappa-B-activating protein 413, is a member of the Nedd4 family. NDFIP2 activates the HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2. NDFIP2 also recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. NDFIP2 may also play a role in modulating EGFR signaling and other cellular processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDFIP2
• Entrez:
  • 54602(Human)
• Uniprot:
  • AAH26126.1(Human)