NDFIP2 Antibody - Azide and BSA Free Summary
| Immunogen |
NDFIP2 (AAH26126.1, 1 a.a. - 242 a.a.) full-length human protein. MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAVSSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL |
| Specificity |
NDFIP2 - Nedd4 family interacting protein 2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
NDFIP2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NDFIP2 Antibody - Azide and BSA Free
Background
NDFIP2, also known as NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, putative MAPK-activating protein PM04/PM05/PM06/PM07 and putative NF-kappa-B-activating protein 413, is a member of the Nedd4 family. NDFIP2 activates the HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2. NDFIP2 also recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. NDFIP2 may also play a role in modulating EGFR signaling and other cellular processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: InhibAct
Species: Hu
Applications: WB
Publications for NDFIP2 Antibody (H00054602-B02P) (0)
There are no publications for NDFIP2 Antibody (H00054602-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDFIP2 Antibody (H00054602-B02P) (0)
There are no reviews for NDFIP2 Antibody (H00054602-B02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NDFIP2 Antibody (H00054602-B02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NDFIP2 Products
Research Areas for NDFIP2 Antibody (H00054602-B02P)
Find related products by research area.
|
Blogs on NDFIP2