NDFIP1 Antibody - BSA Free

Western Blot: NDFIP1 Antibody [NBP1-81234] - Analysis in human cell line RPMI-8226.

Immunohistochemistry-Paraffin: NDFIP1 Antibody [NBP1-81234] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: NDFIP1 Antibody [NBP1-81234] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NDFIP1 Antibody [NBP1-81234] - Staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.

Immunohistochemistry-Paraffin: NDFIP1 Antibody [NBP1-81234] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDFIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDFIP1 Antibody - BSA Free (NBP1-81234) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDFIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDFIP1 Protein (NBP1-81234PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDFIP1 Antibody - BSA Free

• Breast cancer-associated protein SGA-1M
• MGC10924
• N4WBP5
• N4WBP5Putative NF-kappa-B-activating protein 164
• NDFIP1
• Nedd4 family interacting protein 1
• NEDD4 family-interacting protein 1
• NEDD4 WW domain-binding protein 5
• Putative MAPK-activating protein PM13
• Putative NFKB and MAPK-activating protein

Background

Ndfip1 is encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of integral Golgi membrane proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDFIP1