Recombinant Human NCBP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NCBP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-99 of Human NCBP1

Source: Wheat Germ

Amino Acid Sequence: SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCBP1 Protein

  • CBP80nuclear cap binding protein subunit 1, 80kD
  • NCBP 80 kDa subunit
  • NCBPMGC2087
  • nuclear cap binding protein subunit 1, 80kDa
  • nuclear cap-binding protein subunit 1,80 kDa nuclear cap-binding protein
  • Sto1

Background

NCBP1 - nuclear cap binding protein subunit 1, 80kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-370
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00008846-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56198
Species: Hu, Dr
Applications: EM, PEP-ELISA
NBP1-83007
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46321
Species: Hu
Applications: WB, IHC
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready

Publications for NCBP1 Partial Recombinant Protein (H00004686-Q01) (0)

There are no publications for NCBP1 Partial Recombinant Protein (H00004686-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCBP1 Partial Recombinant Protein (H00004686-Q01) (0)

There are no reviews for NCBP1 Partial Recombinant Protein (H00004686-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCBP1 Partial Recombinant Protein (H00004686-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCBP1 Products

Bioinformatics Tool for NCBP1 Partial Recombinant Protein (H00004686-Q01)

Discover related pathways, diseases and genes to NCBP1 Partial Recombinant Protein (H00004686-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCBP1 Partial Recombinant Protein (H00004686-Q01)

Discover more about diseases related to NCBP1 Partial Recombinant Protein (H00004686-Q01).
 

Pathways for NCBP1 Partial Recombinant Protein (H00004686-Q01)

View related products by pathway.

PTMs for NCBP1 Partial Recombinant Protein (H00004686-Q01)

Learn more about PTMs related to NCBP1 Partial Recombinant Protein (H00004686-Q01).

Blogs on NCBP1

There are no specific blogs for NCBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NCBP1 Antibody
NBP2-33897
eIF4G1 Antibody
NB100-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCBP1