NAV2 Antibody

Images

 
Immunohistochemistry-Paraffin: NAV2 Antibody [NBP1-84616] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAV2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LREPSKTALGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLRRLFGGKPTKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAV2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NAV2 Protein (NBP1-84616PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAV2 Antibody

  • EC 3.6.4.12
  • FLJ10633
  • FLJ11030
  • FLJ23707
  • HELAD1UNC53H2
  • Helicase APC down-regulated 1
  • KIAA1419STEERIN2
  • neuron navigator 2
  • POMFIL2helicase, APC down-regulated 1
  • pore membrane and/or filament interacting like protein 2
  • Pore membrane and/or filament-interacting-like protein 2
  • RAINB1FLJ77876
  • retinoic acid inducible gene in neuroblastoma 1
  • Retinoic acid inducible in neuroblastoma 1
  • steerin-2
  • Unc-53 homolog 2
  • unc53H2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84082
Species: Hu
Applications: IHC, IHC-P
AF2948
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-60052
Species: Hu
Applications: WB
MAB4960
Species: Mu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4828
Species: Hu, Mu
Applications: WB, IHC
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84616
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for NAV2 Antibody (NBP1-84616) (0)

There are no publications for NAV2 Antibody (NBP1-84616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAV2 Antibody (NBP1-84616) (0)

There are no reviews for NAV2 Antibody (NBP1-84616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NAV2 Antibody (NBP1-84616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAV2 Products

Bioinformatics Tool for NAV2 Antibody (NBP1-84616)

Discover related pathways, diseases and genes to NAV2 Antibody (NBP1-84616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAV2 Antibody (NBP1-84616)

Discover more about diseases related to NAV2 Antibody (NBP1-84616).
 

Pathways for NAV2 Antibody (NBP1-84616)

View related products by pathway.

PTMs for NAV2 Antibody (NBP1-84616)

Learn more about PTMs related to NAV2 Antibody (NBP1-84616).

Blogs on NAV2

There are no specific blogs for NAV2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAV2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAV2