NAT13 Antibody - BSA Free

Western Blot: NAT13 Antibody [NBP1-55172] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml

Western Blot: NAT13 Antibody [NBP1-55172] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NAT13 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NAT13(N-acetyltransferase 13) The peptide sequence was selected from the C terminal of NAT13. Peptide sequence AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAA50
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NAT13 Antibody - BSA Free

• EC 2.3.1.-
• FLJ13194
• hSAN
• Mak3 homolog (S. cerevisiae)
• N(alpha)-acetyltransferase 50, NatE catalytic subunit
• N-acetyltransferase 13 (GCN5-related)
• N-acetyltransferase 5
• N-acetyltransferase san homolog
• NAT13San
• NAT5SAN
• NatE catalytic subunit
• separation anxiety

Background

NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAA50
• Uniprot:
  • Q9GZZ1(Human)