MAK10 Antibody

Images

 
Western Blot: MAK10 Antibody [NBP1-90032] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MAK10 Antibody [NBP1-90032] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAK10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
MAK10 Protein (NBP1-90032PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAK10 Antibody

  • bA379P1.1
  • corneal wound healing-related protein
  • EGAP
  • embryonic growth-associated protein homolog
  • FLJ21613
  • FLJ22643
  • MAK10 homolog, amino-acid N-acetyltransferase subunit
  • MAK10
  • N(alpha)-acetyltransferase 35, NatC auxiliary subunit
  • N-alpha-acetyltransferase 35, NatC auxiliary subunit
  • protein MAK10 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55172
Species: Hu
Applications: WB
H00057538-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00004117-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-74258
Species: Hu
Applications: WB
H00054504-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-19461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NBP2-24689
Species: Hu, Mu
Applications: WB
NBL1-17720
Species: Hu
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-02316
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90032
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MAK10 Antibody (NBP1-90032) (0)

There are no publications for MAK10 Antibody (NBP1-90032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAK10 Antibody (NBP1-90032) (0)

There are no reviews for MAK10 Antibody (NBP1-90032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAK10 Antibody (NBP1-90032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAK10 Products

MAK10 NBP1-90032

Bioinformatics Tool for MAK10 Antibody (NBP1-90032)

Discover related pathways, diseases and genes to MAK10 Antibody (NBP1-90032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAK10 Antibody (NBP1-90032)

Discover more about diseases related to MAK10 Antibody (NBP1-90032).
 

Pathways for MAK10 Antibody (NBP1-90032)

View related products by pathway.

PTMs for MAK10 Antibody (NBP1-90032)

Learn more about PTMs related to MAK10 Antibody (NBP1-90032).

Blogs on MAK10

There are no specific blogs for MAK10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAK10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA35