NAT1 Antibody

Images

 
Western Blot: NAT1 Antibody [H00000009-D01P] - Analysis of NAT1 expression in transfected 293T cell line by NAT1 polyclonal antibody.Lane 1: NAT1 transfected lysate(33.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAT1 Antibody Summary

Immunogen
NAT1 (NP_000653.3, 1 a.a. - 290 a.a.) full-length human protein. MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Specificity
Reacts with N-acetyltransferase 1 (arylamine N-acetyltransferase).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAT1 Antibody

  • AAC1N-acetyltransferase type 1
  • Arylamide acetylase 1
  • arylamine N-acetyltransferase 1
  • EC 2.3.1.5
  • MNAT
  • Monomorphic arylamine N-acetyltransferase
  • N-acetyltransferase 1 (arylamine N-acetyltransferase)
  • NAT-1
  • NATI

Background

This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human geneome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NAT1 Antibody (H00000009-D01P) (0)

There are no publications for NAT1 Antibody (H00000009-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT1 Antibody (H00000009-D01P) (0)

There are no reviews for NAT1 Antibody (H00000009-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAT1 Antibody (H00000009-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAT1 Products

Bioinformatics Tool for NAT1 Antibody (H00000009-D01P)

Discover related pathways, diseases and genes to NAT1 Antibody (H00000009-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT1 Antibody (H00000009-D01P)

Discover more about diseases related to NAT1 Antibody (H00000009-D01P).
 

Pathways for NAT1 Antibody (H00000009-D01P)

View related products by pathway.

PTMs for NAT1 Antibody (H00000009-D01P)

Learn more about PTMs related to NAT1 Antibody (H00000009-D01P).

Blogs on NAT1

There are no specific blogs for NAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT1
Entrez
Uniprot