NARF Antibody - BSA Free

Western Blot: NARF Antibody [NBP3-09323] - Western blot analysis using NBP3-09323 on Human Liver as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NARF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NARF Antibody - BSA Free (NBP3-09323) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NARF (NP_001033707). Peptide sequence RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NARF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NARF Antibody - BSA Free

• FLJ10067
• IOP2DKFZp434G0420
• Iron-only hydrogenase-like protein 2
• nuclear prelamin A recognition factor
• prenyl-dependent prelamin A binding protein

Background

NARF (Nuclear Prelamin A Recognition Factor) is involved in electron transport, heterochromatin organization and regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor. NARF is known to have interactions with LMNA, LMNB1, PCB4, QKI and TAF9. NARF has been studied in relation to glaucoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NARF