NALP4 Recombinant Protein Antigen

Images

 
There are currently no images for NALP4 Recombinant Protein Antigen (NBP3-17191PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NALP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NALP4

Source: E. coli

Amino Acid Sequence: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17191.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NALP4 Recombinant Protein Antigen

  • Cancer/testis antigen 58
  • CLR19.5
  • CT58PYRIN and NACHT-containing protein 2
  • FLJ32126
  • NACHT, leucine rich repeat and PYD containing 4
  • NACHT, LRR and PYD domains-containing protein 4
  • NALP4NACHT, LRR and PYD containing protein 4
  • NLR family, pyrin domain containing 4
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 4
  • PAN2Ribonuclease inhibitor 2
  • PYPAF4PAAD and NACHT-containing protein 2
  • RNH2PYRIN-containing APAF1-like protein 4

Background

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP4, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes (Tschopp et al., 2003).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48703
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-46321
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP2-44286
Species: Hu
Applications: IP, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
NBP3-47570
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for NALP4 Recombinant Protein Antigen (NBP3-17191PEP) (0)

There are no publications for NALP4 Recombinant Protein Antigen (NBP3-17191PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NALP4 Recombinant Protein Antigen (NBP3-17191PEP) (0)

There are no reviews for NALP4 Recombinant Protein Antigen (NBP3-17191PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NALP4 Recombinant Protein Antigen (NBP3-17191PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NALP4 Products

Blogs on NALP4.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

NALP4 - Mediator of Programmed Cell Death
The NALP family consists of cytoplasmic proteins within the larger CATERPILLER protein family. There exist in short forms (such as NALP4) and long forms (NALP1). NALP proteins include the apoptosis regulator apoptotic protease activating factor 1 (APA...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NALP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP4