NACA2 Antibody

Images

 
Western Blot: NACA2 Antibody [H00342538-B01P] - Analysis of NACA2 expression in transfected 293T cell line by NACA2 polyclonal antibody. Lane 1: NACAL transfected lysate(23.65 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: NACA2 Antibody [H00342538-B01P] - Analysis of purified antibody to NACAL on HepG2 cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NACA2 Antibody Summary

Immunogen
NACAL (NP_954984.1, 1 a.a. - 215 a.a.) full-length human protein. MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Specificity
NACAL - nascent-polypeptide-associated complex alpha polypeptide-like,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NACA2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NACA2 Antibody

  • alpha-NAC protein
  • Alpha-NAC-like
  • ANAC
  • hom s 2.01 protein
  • Hom s 2.01
  • IgE autoantigen alpha-nascent polypeptide-associated complex
  • MGC71999
  • NACAL
  • NAC-alpha-like
  • nascent polypeptide-associated complex alpha subunit 2
  • nascent polypeptide-associated complex subunit alpha-2
  • Nascent polypeptide-associated complex subunit alpha-like
  • nascent polypeptide-associated complex, alpha polypeptide, 2
  • nascent-polypeptide-associated complex alpha polypeptide-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004666-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-56148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-94316
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-85889
Species: Hu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for NACA2 Antibody (H00342538-B01P) (0)

There are no publications for NACA2 Antibody (H00342538-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NACA2 Antibody (H00342538-B01P) (0)

There are no reviews for NACA2 Antibody (H00342538-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NACA2 Antibody (H00342538-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NACA2 Products

Bioinformatics Tool for NACA2 Antibody (H00342538-B01P)

Discover related pathways, diseases and genes to NACA2 Antibody (H00342538-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NACA2 Antibody (H00342538-B01P)

Discover more about diseases related to NACA2 Antibody (H00342538-B01P).

Blogs on NACA2

There are no specific blogs for NACA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NACA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NACA2
Entrez
Uniprot