Nab2 Recombinant Protein Antigen

Images

 
There are currently no images for Nab2 Protein (NBP1-82804PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nab2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAB2.

Source: E. coli

Amino Acid Sequence: HPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82804.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nab2 Recombinant Protein Antigen

  • EGR-1-binding protein 2
  • MADEREGR1 binding protein 2
  • Melanoma-associated delayed early response protein
  • MGC75085
  • NGFI-A binding protein 2 (EGR1 binding protein 2)
  • NGFI-A-binding protein 2
  • Protein MADER

Background

Transcriptional control is in part regulated by interactions between DNA-bound transcription factors, such as Egr-1/NGFI-A, and coregulatory proteins, such as NAB (for NGFI-A-binding proteins). The evolutionarily conserved NAB proteins, NAB1 and NAB2, are corepressors of EGF-1/NGFI-A. Both NAB1 and NAB2 contain an amino terminal NAB conserved domain 1 (NCB1), which is required for binding NGFI-A, and a carboxy terminal NCD2 domain, which is responsible for the repressor function of NAB proteins. NAB2 is principally localized in the nucleus and may play a role in the downregulation of NGFI-A activity as well as in controlling fundamental processes such as cell division, differentiation and apoptosis. NAB2 has a predicted molecular mass of 56 kDa and localizes to chromosome 12q13.3-14.1, a region that is rearranged in several solid tumors, lipomas and liposarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2818
Species: Hu
Applications: ICC, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-71838
Species: Hu, Mu
Applications: ChIP, IP, Simple Western, WB
NBP1-80903
Species: Hu
Applications: IHC,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
233-FB
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF932
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
202-IL
Species: Hu
Applications: BA
NBP1-82804PEP
Species: Hu
Applications: AC

Publications for Nab2 Protein (NBP1-82804PEP) (0)

There are no publications for Nab2 Protein (NBP1-82804PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nab2 Protein (NBP1-82804PEP) (0)

There are no reviews for Nab2 Protein (NBP1-82804PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nab2 Protein (NBP1-82804PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nab2 Products

Research Areas for Nab2 Protein (NBP1-82804PEP)

Find related products by research area.

Blogs on Nab2

There are no specific blogs for Nab2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nab2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NAB2