NAALADase-2/NAALAD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NAALADase-2/NAALAD2 Antibody [NBP2-56951] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: NAALADase-2/NAALAD2 Antibody [NBP2-56951] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NAALADase-2/NAALAD2 Antibody [NBP2-56951] -Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NAALADase-2/NAALAD2 Antibody [NBP2-56951] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NAALADase-2/NAALAD2 Antibody [NBP2-56951] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAALADase-2/NAALAD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NDAEILLRYLGGIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNIN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAALAD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAALADase-2/NAALAD2 Recombinant Protein Antigen (NBP2-56951PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NAALADase-2/NAALAD2 Antibody - BSA Free

• GCPIII
• Glutamate Carboxypeptidase III
• GPCIII
• MGC116996
• MGC26353
• NAADALASE2
• NAALAD2
• NAALADase II
• NAALADase2
• NAALADase-2
• N-acetylated alpha-linked acidic dipeptidase 2
• N-acetylated alpha-linked acidic dipeptidase II
• N-acetylated-alpha-linked acidic dipeptidase 2
• N-acetylated-alpha-linked acidic dipeptidase II

Background

The NAALAD2 gene is a member of the N-acetylated alpha-linked acidic dipeptidase (NAALADase) gene family. The representative member of this family is the gene encoding human prostate-specific membrane antigen (PSM), which is a marker of prostatic carcinomas and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAALAD2