NAALADase-2/NAALAD2 Antibody


Immunohistochemistry-Paraffin: NAALADase-2/NAALAD2 Antibody [NBP2-31840] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

NAALADase-2/NAALAD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQLTDHGVSF
Specificity of human NAALADase-2/NAALAD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NAALADase-2/NAALAD2 Protein (NBP2-31840PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NAALADase-2/NAALAD2 Antibody

  • Glutamate Carboxypeptidase III
  • MGC116996
  • MGC26353
  • NAALADase II
  • NAALADase2
  • NAALADase-2
  • N-acetylated alpha-linked acidic dipeptidase 2
  • N-acetylated alpha-linked acidic dipeptidase II
  • N-acetylated-alpha-linked acidic dipeptidase 2
  • N-acetylated-alpha-linked acidic dipeptidase II


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AdBlk
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for NAALADase-2/NAALAD2 Antibody (NBP2-31840) (0)

There are no publications for NAALADase-2/NAALAD2 Antibody (NBP2-31840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAALADase-2/NAALAD2 Antibody (NBP2-31840) (0)

There are no reviews for NAALADase-2/NAALAD2 Antibody (NBP2-31840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NAALADase-2/NAALAD2 Antibody (NBP2-31840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NAALADase-2/NAALAD2 Products

Bioinformatics Tool for NAALADase-2/NAALAD2 Antibody (NBP2-31840)

Discover related pathways, diseases and genes to NAALADase-2/NAALAD2 Antibody (NBP2-31840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NAALADase-2/NAALAD2 Antibody (NBP2-31840)

View related products by pathway.

PTMs for NAALADase-2/NAALAD2 Antibody (NBP2-31840)

Learn more about PTMs related to NAALADase-2/NAALAD2 Antibody (NBP2-31840).

Blogs on NAALADase-2/NAALAD2

There are no specific blogs for NAALADase-2/NAALAD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NAALADase-2/NAALAD2 Antibody and receive a gift card or discount.


Gene Symbol NAALAD2