N4BP2L2 Antibody - BSA Free

Western Blot: N4BP2L2 Antibody [NBP1-57762] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

N4BP2L2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RP11-298P3.3 (NEDD4 binding protein 2-like 2) The peptide sequence was selected from the N terminal of RP11-298P3.3)(50ug). Peptide sequence EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: N4BP2L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for N4BP2L2 Antibody - BSA Free

• CG005FLJ41089
• CG016
• FLJ36195
• NEDD4 binding protein 2-like 2
• NEDD4-binding protein 2-like 2
• PFAAP5FLJ43077
• Phosphonoformate immuno-associated protein 5,92M18.3,92M18.3 (novel protein)
• protein from BCRA2 region

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: N4BP2L2