TSGA2 Antibody

Images

 
Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human testis shows cytoplasmic positivity in spermatocytes and spermatids.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSGA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSGA2 Protein (NBP1-89839PEP)
Publications
Read Publications using NBP1-89839.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Reactivity reported in scientific literature (PMID: 23993197)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSGA2 Antibody

  • Cancer/testis antigen 79
  • CT79
  • FLJ32753
  • h-meichroacidin
  • Male meiotic metaphase chromosome-associated acidic protein
  • meichroacidin
  • radial spoke head 1 homolog (Chlamydomonas)
  • radial spoke head 1 homolog
  • RSP44
  • RSPH10A
  • testes specific A2 homolog
  • testes specific gene A2 homolog
  • testis specific A2 homolog (mouse)
  • testis specific A2 homolog
  • Testis-specific gene A2 protein
  • TSA2MGC126568
  • TSGA2MGC141927

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004061-D01P
Species: Hu
Applications: WB
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00149420-P01
Species: Hu
AF2485
Species: Hu
Applications: WB, IHC, IP
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37395
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91799
Species: Hu
Applications: WB, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89839
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for TSGA2 Antibody (NBP1-89839)(2)

Reviews for TSGA2 Antibody (NBP1-89839) (0)

There are no reviews for TSGA2 Antibody (NBP1-89839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TSGA2 Antibody (NBP1-89839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSGA2 Products

Bioinformatics Tool for TSGA2 Antibody (NBP1-89839)

Discover related pathways, diseases and genes to TSGA2 Antibody (NBP1-89839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA2 Antibody (NBP1-89839)

Discover more about diseases related to TSGA2 Antibody (NBP1-89839).
 

Pathways for TSGA2 Antibody (NBP1-89839)

View related products by pathway.

PTMs for TSGA2 Antibody (NBP1-89839)

Learn more about PTMs related to TSGA2 Antibody (NBP1-89839).
 

Research Areas for TSGA2 Antibody (NBP1-89839)

Find related products by research area.

Blogs on TSGA2

There are no specific blogs for TSGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSGA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSPH1