TSGA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody NBP1-89839 (A) shows similar protein distribution across tissues to independent antibody NBP1-89840 (B).

Analysis in human fallopian tube and cerebral cortex tissues using NBP1-89839 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSGA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSGA2 Antibody - BSA Free (NBP1-89839) is a polyclonal antibody validated for use in IHC and WB. Anti-TSGA2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RSPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID: 30896965)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TSGA2 Protein (NBP1-89839PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30896965).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TSGA2 Antibody - BSA Free

• Cancer/testis antigen 79
• CT79
• FLJ32753
• h-meichroacidin
• Male meiotic metaphase chromosome-associated acidic protein
• meichroacidin
• radial spoke head 1 homolog (Chlamydomonas)
• radial spoke head 1 homolog
• RSP44
• RSPH10A
• testes specific A2 homolog
• testes specific gene A2 homolog
• testis specific A2 homolog (mouse)
• testis specific A2 homolog
• Testis-specific gene A2 protein
• TSA2MGC126568
• TSGA2MGC141927

Background

TSGA2 may play an important role in male meiosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSGA2 Antibody (NBP1-89839)(4)

Publications using NBP1-89839

• Zhang X, Xiao Z, Zhang J et al. Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella Cell reports 2022-11-22 [PMID: 36417862] (WB, Mouse)
• Yin W, Livraghi-Butrico A, Sears PR et al. Mice with a Deletion of Rsph1 Exhibit a Low Level of Mucociliary Clearance and Develop a PCD Phenotype Am. J. Respir. Cell Mol. Biol. 2019-03-21 [PMID: 30896965] (WB, Mouse)
• Onoufriadis A, Shoemark A, Schmidts M et al. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Hum Mol Genet 2014-07-01 [PMID: 24518672]
• Kott E, Legendre M, Copin B et al. Loss-of-Function Mutations in RSPH1 Cause Primary Ciliary Dyskinesia with Central-Complex and Radial-Spoke Defects. Am J Hum Genet 2013-09-05 [PMID: 23993197]

Bioinformatics

• Gene Symbol: RSPH1