N4BP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: N4BP1 Antibody [NBP1-86238] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: N4BP1 Antibody [NBP1-86238] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N4BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
N4BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
N4BP1 Protein (NBP1-86238PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N4BP1 Antibody

  • FLJ31821
  • KIAA0615
  • MGC176730
  • NEDD4 binding protein 1
  • NEDD4-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP2-46405
Species: Hu
Applications: WB, IHC
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP2-37472
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-54944
Species: Hu
Applications: ICC/IF
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-84293
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF8246
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90060
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for N4BP1 Antibody (NBP1-86238) (0)

There are no publications for N4BP1 Antibody (NBP1-86238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N4BP1 Antibody (NBP1-86238) (0)

There are no reviews for N4BP1 Antibody (NBP1-86238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for N4BP1 Antibody (NBP1-86238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N4BP1 Products

N4BP1 NBP1-86238

Bioinformatics Tool for N4BP1 Antibody (NBP1-86238)

Discover related pathways, diseases and genes to N4BP1 Antibody (NBP1-86238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N4BP1 Antibody (NBP1-86238)

Discover more about diseases related to N4BP1 Antibody (NBP1-86238).
 

Pathways for N4BP1 Antibody (NBP1-86238)

View related products by pathway.

PTMs for N4BP1 Antibody (NBP1-86238)

Learn more about PTMs related to N4BP1 Antibody (NBP1-86238).

Blogs on N4BP1

There are no specific blogs for N4BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N4BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol N4BP1