N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NDST1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody - BSA Free
Background
Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine(GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backboneto make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a rolein determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence isabsolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands,thereby playing a role in inflammatory response
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978) (0)
There are no publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978) (0)
There are no reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional N-Deacetylase/N-Sulfotransferase 1/NDST1 Products
Research Areas for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (NBP2-37978)
Find related products by research area.
|
Blogs on N-Deacetylase/N-Sulfotransferase 1/NDST1