N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4)

Images

 
Western Blot: N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4) [H00004248-M01] - Analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody (M01), clone 2G4.Lane 1: MGAT3 transfected ...read more
Immunoprecipitation: N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4) [H00004248-M01] - Analysis of MGAT3 transfected lysate using anti-MGAT3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4) Summary

Immunogen
MGAT3 (NP_002400 430 a.a. - 531 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
Specificity
MGAT3 - mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MGAT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4)

  • beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  • EC 2.4.1.144
  • FLJ43371
  • GGNT3
  • GlcNAc-T III
  • GNT3
  • GNT-III
  • GNT-IIIMGC142278
  • mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • MGAT3
  • MGC141943
  • N-acetylglucosaminyltransferase III
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III

Background

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5469
Species: Hu
Applications: WB, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2009
Species: Hu
Applications: WB, IHC
NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5768
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-14235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01) (0)

There are no publications for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01) (0)

There are no reviews for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Acetylglucosaminyltransferase III/MGAT3 Products

Bioinformatics Tool for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01)

Discover related pathways, diseases and genes to N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01)

Discover more about diseases related to N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01).
 

Pathways for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01)

View related products by pathway.

PTMs for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01)

Learn more about PTMs related to N-Acetylglucosaminyltransferase III/MGAT3 Antibody (H00004248-M01).

Blogs on N-Acetylglucosaminyltransferase III/MGAT3

There are no specific blogs for N-Acetylglucosaminyltransferase III/MGAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Acetylglucosaminyltransferase III/MGAT3 Antibody (2G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT3
Entrez
OMIM
Uniprot