MYST3 Antibody (4D8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK |
| Specificity |
Reacts with MYST histone acetyltransferase (monocytic leukemia) 3. |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KAT6A |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is reactive against recombinant protein in WB and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MYST3 Antibody (4D8) - Azide and BSA Free
Background
MYST3 is a component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Histone acetyltransferase which may act as a transcriptional coactivator for RUNX1 and RUNX2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Publications for MYST3 Antibody (H00007994-M07)(2)
Showing Publications 1 -
2 of 2.
| Publications using H00007994-M07 |
Applications |
Species |
| Pei G, Kun Z, Wuhao L et al. miR-339-3p inhibits cell growth and epithelial-mesenchymal transition in nasopharyngeal carcinoma by modulating the KAT6A/TRIM24 axis. Int J Clin Oncol. 2022-08-17 [PMID: 35976474] |
|
|
| W Liu, Z Zhan, M Zhang, B Sun, Q Shi, F Luo, M Zhang, W Zhang, Y Hou, X Xiao, Y Li, H Feng KAT6A, a novel regulator of &beta-catenin, promotes tumorigenicity and chemoresistance in ovarian cancer by acetylating COP1 Theranostics, 2021-04-15;11(13):6278-6292. 2021-04-15 [PMID: 33995658] |
|
|
Reviews for MYST3 Antibody (H00007994-M07) (0)
There are no reviews for MYST3 Antibody (H00007994-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MYST3 Antibody (H00007994-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MYST3 Products
Research Areas for MYST3 Antibody (H00007994-M07)
Find related products by research area.
|
Blogs on MYST3