MYST3 Antibody (4D8)

Images

 
Immunohistochemistry-Paraffin: MYST3 Antibody (4D8) [H00007994-M07] - Analysis of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Sandwich ELISA: MYST3 Antibody (4D8) [H00007994-M07] - Detection limit for recombinant GST tagged MYST3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYST3 Antibody (4D8) Summary

Immunogen
MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Specificity
Reacts with MYST histone acetyltransferase (monocytic leukemia) 3.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KAT6A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYST3 Antibody (4D8)

  • EC 2.3.1.48
  • EC 3.1.26.4
  • histone acetyltransferase MYST3
  • KAT6A
  • MGC167033
  • MOZ
  • MOZMonocytic leukemia zinc finger protein
  • MYST histone acetyltransferase (monocytic leukemia) 3
  • MYST3
  • MYST-3
  • runt-related transcription factor binding protein 2
  • Runt-related transcription factor-binding protein 2
  • RUNXBP2
  • Zinc finger protein 220
  • ZNF220
  • ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3

Background

MYST3 is a component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Histone acetyltransferase which may act as a transcriptional coactivator for RUNX1 and RUNX2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-02990
Species: Hu, Mu, Rt
Applications: WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
H00027130-P02
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-55251
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for MYST3 Antibody (H00007994-M07) (0)

There are no publications for MYST3 Antibody (H00007994-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYST3 Antibody (H00007994-M07) (0)

There are no reviews for MYST3 Antibody (H00007994-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYST3 Antibody (H00007994-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYST3 Products

Array H00007994-M07

Bioinformatics Tool for MYST3 Antibody (H00007994-M07)

Discover related pathways, diseases and genes to MYST3 Antibody (H00007994-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYST3 Antibody (H00007994-M07)

Discover more about diseases related to MYST3 Antibody (H00007994-M07).
 

Pathways for MYST3 Antibody (H00007994-M07)

View related products by pathway.

PTMs for MYST3 Antibody (H00007994-M07)

Learn more about PTMs related to MYST3 Antibody (H00007994-M07).
 

Research Areas for MYST3 Antibody (H00007994-M07)

Find related products by research area.

Blogs on MYST3

There are no specific blogs for MYST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYST3 Antibody (4D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT6A
Entrez
Uniprot