MYSM1 Antibody

Immunohistochemistry: MYSM1 Antibody [NBP2-33709] - Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.

Product Discontinued

MYSM1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KQDETLSSSEITLWTEKQSNGDKKSIELNDQKFNELIKNCNKHDGRGIIVDARQLPSPEPCEIQKNLNDNEMLFHSCQMVEESHEEEELK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYSM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MYSM1 Protein (NBP2-33709PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MYSM1 Antibody

• 2A-DUB
• DKFZp779J1554
• DKFZp779J1721,2A-DUB
• Histone H2A Deubiquitinase MYSM1
• KIAA1915
• Myb-like, SWIRM and MPN domains 1,2ADUB
• MYSM1
• RP4-592A1.1
• SWIRM and MPN domain-containing protein 1

Background

Metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. Preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. Acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYSM1
• Uniprot:
  • Q5VVJ2()