myosin X Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: myosin X Antibody [NBP1-87748] - Staining of human cell line U-2 OS shows positivity in nucleoli, plasma membrane and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry: myosin X Antibody [NBP1-87748] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

myosin X Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500-1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
myosin X Protein (NBP1-87748PEP)
Publications
Read Publications using
NBP1-87748 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22661706)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for myosin X Antibody

  • FLJ10639
  • FLJ21066
  • FLJ22268
  • KIAA0799FLJ43256
  • MGC131988
  • myosin X
  • myosin-X
  • Unconventional myosin-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
AF844
Species: Mu
Applications: WB, Block
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-18932
Species: Hu, Mu
Applications: IP (-), WB
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-87748
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for myosin X Antibody (NBP1-87748)(4)

Reviews for myosin X Antibody (NBP1-87748) (0)

There are no reviews for myosin X Antibody (NBP1-87748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for myosin X Antibody (NBP1-87748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional myosin X Products

Bioinformatics Tool for myosin X Antibody (NBP1-87748)

Discover related pathways, diseases and genes to myosin X Antibody (NBP1-87748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for myosin X Antibody (NBP1-87748)

Discover more about diseases related to myosin X Antibody (NBP1-87748).
 

Pathways for myosin X Antibody (NBP1-87748)

View related products by pathway.

PTMs for myosin X Antibody (NBP1-87748)

Learn more about PTMs related to myosin X Antibody (NBP1-87748).

Blogs on myosin X

There are no specific blogs for myosin X, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our myosin X Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO10