Myosin Phosphatase Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEELK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP1R12A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Myosin Phosphatase Antibody - BSA Free
Background
The major protein phosphatase-1 (PP1) is composed of 3 subunits with apparent molecular mass of 110-130, 37 & 20 kDa. The 110-130 kDa component act as a regulatory subunit known as myosine binding (MBS) or myosine phosphatae targeting subunit (MYPT). The N-terminal portion of MYPT binds to both PP1c-delta and phosphorylated myosin, thereby increasing myosin phosphatase activity. Two isoform of MYPT have been identified (MYPT1 & MYPT2) and share 61% sequence identity. While MYPT1 is widely distributed in human tissues, MYPT2 is mostly detected in brain and heart.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, KD, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Myosin Phosphatase Antibody (NBP2-58950) (0)
There are no publications for Myosin Phosphatase Antibody (NBP2-58950).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin Phosphatase Antibody (NBP2-58950) (0)
There are no reviews for Myosin Phosphatase Antibody (NBP2-58950).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin Phosphatase Antibody (NBP2-58950) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin Phosphatase Products
Research Areas for Myosin Phosphatase Antibody (NBP2-58950)
Find related products by research area.
|
Blogs on Myosin Phosphatase