Myosin Phosphatase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP2-58950] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin Phosphatase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEELK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R12A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP)

Reactivity Notes

Mouse 87%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Myosin Phosphatase Antibody

  • MBSmyosin phosphatase, target subunit 1
  • MGC133042
  • Myosin phosphatase target subunit 1
  • Myosin phosphatase-targeting subunit 1
  • MYPT1protein phosphatase 1 regulatory subunit 12A
  • protein phosphatase 1, regulatory (inhibitor) subunit 12A
  • Protein phosphatase myosin-binding subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37897
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-624
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00085366-M01
Species: Hu, Mu
Applications: ELISA, KD, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP2-14843
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Myosin Phosphatase Antibody (NBP2-58950) (0)

There are no publications for Myosin Phosphatase Antibody (NBP2-58950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Phosphatase Antibody (NBP2-58950) (0)

There are no reviews for Myosin Phosphatase Antibody (NBP2-58950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myosin Phosphatase Antibody (NBP2-58950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Phosphatase Products

Bioinformatics Tool for Myosin Phosphatase Antibody (NBP2-58950)

Discover related pathways, diseases and genes to Myosin Phosphatase Antibody (NBP2-58950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Phosphatase Antibody (NBP2-58950)

Discover more about diseases related to Myosin Phosphatase Antibody (NBP2-58950).
 

Pathways for Myosin Phosphatase Antibody (NBP2-58950)

View related products by pathway.

PTMs for Myosin Phosphatase Antibody (NBP2-58950)

Learn more about PTMs related to Myosin Phosphatase Antibody (NBP2-58950).
 

Research Areas for Myosin Phosphatase Antibody (NBP2-58950)

Find related products by research area.

Blogs on Myosin Phosphatase

There are no specific blogs for Myosin Phosphatase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Phosphatase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R12A