Myosin Light Chain 2 Antibody (3B9-B4)

Images

 
Immunocytochemistry/ Immunofluorescence: Myosin Light Chain 2 Antibody (3B9-B4) [H00004633-M01] - Analysis of monoclonal antibody to MYL2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Myosin Light Chain 2 Antibody (3B9-B4) [H00004633-M01] - Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.
Immunoprecipitation: Myosin Light Chain 2 Antibody (3B9-B4) [H00004633-M01] - Analysis of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MYL2 MaxPab ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
3B9-B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Myosin Light Chain 2 Antibody (3B9-B4) Summary

Immunogen
MYL2 (AAH15821.1, 1 a.a. - 166 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Specificity
MYL2 - myosin, light polypeptide 2, regulatory, cardiac, slow
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004633-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myosin Light Chain 2 Antibody (3B9-B4)

  • cardiac ventricular myosin light chain 2
  • CMH10myosin light chain 2
  • DKFZp779C0562
  • MLC2
  • MLC-2
  • MLC-2v
  • myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  • myosin, light chain 2, regulatory, cardiac, slow
  • myosin, light polypeptide 2, regulatory, cardiac, slow
  • regulatory light chain of myosin
  • RLC of myosin
  • slow cardiac myosin regulatory light chain 2

Background

Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-98474
Species: Hu
Applications: WB

Publications for Myosin Light Chain 2 Antibody (H00004633-M01)(1)

Reviews for Myosin Light Chain 2 Antibody (H00004633-M01) (0)

There are no reviews for Myosin Light Chain 2 Antibody (H00004633-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myosin Light Chain 2 Antibody (H00004633-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin Light Chain 2 Products

Bioinformatics Tool for Myosin Light Chain 2 Antibody (H00004633-M01)

Discover related pathways, diseases and genes to Myosin Light Chain 2 Antibody (H00004633-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin Light Chain 2 Antibody (H00004633-M01)

Discover more about diseases related to Myosin Light Chain 2 Antibody (H00004633-M01).
 

Pathways for Myosin Light Chain 2 Antibody (H00004633-M01)

View related products by pathway.

PTMs for Myosin Light Chain 2 Antibody (H00004633-M01)

Learn more about PTMs related to Myosin Light Chain 2 Antibody (H00004633-M01).

Blogs on Myosin Light Chain 2

There are no specific blogs for Myosin Light Chain 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin Light Chain 2 Antibody (3B9-B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL2
Entrez
OMIM
Uniprot