Recombinant Human Myosin 1A GST (N-Term) Protein

SDS-Page: Recombinant Human Myosin 1A Protein [H00004640-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human Myosin 1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 944-1043 of Human Myosin 1A
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: MYO1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin 1A GST (N-Term) Protein

• BBMI
• BBM-I
• Brush border myosin I
• brush border myosin-I
• DFNA48
• MIHC
• MYHL
• Myosin I heavy chain
• myosin IA
• myosin, heavy polypeptide-like (100kD)
• myosin-Ia

Background

MYO1A - myosin IA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

FAQs for Myosin 1A Partial Recombinant Protein (H00004640-Q01). (Showing 1 - 1 of 1 FAQ).

1. Regarding H00004640-Q01 & H00004641-P01, has any test been carried out between the myosin recombinant proteins, H00004879-P01 against the MF20? We would like to determine the affinity of whether there has been any reactions conducted.
   • These recombinant proteins are made by a Taiwanese company called Abnova and we distribute for them. We therefore have not done any in-house testing or development of these products. We also, unfortunately, do not carry clone MF20.

Bioinformatics

• Gene Symbol: MYO1A