Recombinant Human Myosin 1A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Myosin 1A Protein [H00004640-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Myosin 1A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 944-1043 of Human Myosin 1A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYO1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin 1A GST (N-Term) Protein

  • BBMI
  • BBM-I
  • Brush border myosin I
  • brush border myosin-I
  • DFNA48
  • MIHC
  • MYHL
  • Myosin I heavy chain
  • myosin IA
  • myosin, heavy polypeptide-like (100kD)
  • myosin-Ia

Background

MYO1A - myosin IA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87739
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87745
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF8181
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-27972
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
210-TA
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NB100-56548
Species: Hu
Applications: ICC/IF, WB
H00000248-M03
Species: Hu
Applications: ELISA, WB
NBP1-92158
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94642
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
H00004640-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Myosin 1A Partial Recombinant Protein (H00004640-Q01) (0)

There are no publications for Myosin 1A Partial Recombinant Protein (H00004640-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin 1A Partial Recombinant Protein (H00004640-Q01) (0)

There are no reviews for Myosin 1A Partial Recombinant Protein (H00004640-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin 1A Partial Recombinant Protein (H00004640-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Regarding H00004640-Q01 & H00004641-P01, has any test been carried out between the myosin recombinant proteins, H00004879-P01 against the MF20? We would like to determine the affinity of whether there has been any reactions conducted.
    • These recombinant proteins are made by a Taiwanese company called Abnova and we distribute for them. We therefore have not done any in-house testing or development of these products. We also, unfortunately, do not carry clone MF20.

Additional Myosin 1A Products

Bioinformatics Tool for Myosin 1A Partial Recombinant Protein (H00004640-Q01)

Discover related pathways, diseases and genes to Myosin 1A Partial Recombinant Protein (H00004640-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin 1A Partial Recombinant Protein (H00004640-Q01)

Discover more about diseases related to Myosin 1A Partial Recombinant Protein (H00004640-Q01).
 

Pathways for Myosin 1A Partial Recombinant Protein (H00004640-Q01)

View related products by pathway.

PTMs for Myosin 1A Partial Recombinant Protein (H00004640-Q01)

Learn more about PTMs related to Myosin 1A Partial Recombinant Protein (H00004640-Q01).
 

Research Areas for Myosin 1A Partial Recombinant Protein (H00004640-Q01)

Find related products by research area.

Blogs on Myosin 1A

There are no specific blogs for Myosin 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin 1A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1A