MYOM1 Recombinant Protein Antigen

Images

 
There are currently no images for MYOM1 Protein (NBP1-86460PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYOM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYOM1.

Source: E. coli

Amino Acid Sequence: GITDTEEERIKEAAAYIAQRNLLASEEGITTPKQSTASKQTTASKQSTASKQSTASKQSTASRQSTASRQSVVSKQATSALQQEETSEKKSRKVVIREKAERLSLRKTLEETETYHAKLNEDHLLHAPEFIIKPRSHTVWEKENV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYOM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86460.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYOM1 Recombinant Protein Antigen

  • 190 kDa connectin-associated protein
  • 190 kDa titin-associated protein
  • EH-myomesin
  • MGC134946
  • MGC134947
  • myomesin (M-protein) 1 (190kD)
  • myomesin 1 (skelemin) (185kD)
  • myomesin 1 (skelemin) 185kDa
  • myomesin 1, 185kDa
  • Myomesin family member 1
  • myomesin-1
  • SKELEMIN

Background

The giant protein titin, together with its associated proteins, interconnects the major structure of sarcomeres, the M bands and Z discs. The C-terminal end of the titin string extends into the M line, where it binds tightly to M-band constituents of apparent molecular masses of 190 kD (myomesin 1) and 165 kD (myomesin 2). This protein, myomesin 1, like myomesin 2, titin, and other myofibrillar proteins contains structural modules with strong homology to either fibronectin type III (motif I) or immunoglobulin C2 (motif II) domains. Myomesin 1 and myomesin 2 each have a unique N-terminal region followed by 12 modules of motif I or motif II, in the arrangement II-II-I-I-I-I-I-II-II-II-II-II. The two proteins share 50% sequence identity in this repeat-containing region. The head structure formed by these 2 proteins on one end of the titin string extends into the center of the M band. The integrating structure of the sarcomere arises from muscle-specific members of the superfamily of immunoglobulin-like proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-87496
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP2-36064
Species: Hu
Applications: IHC, IHC-Fr, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP3-13181
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-55165
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1687
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00004608-M01
Species: Bv, Hu, Mu, Po
Applications: DB, ELISA, S-ELISA, WB
NBP1-86460PEP
Species: Hu
Applications: AC

Publications for MYOM1 Protein (NBP1-86460PEP) (0)

There are no publications for MYOM1 Protein (NBP1-86460PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYOM1 Protein (NBP1-86460PEP) (0)

There are no reviews for MYOM1 Protein (NBP1-86460PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYOM1 Protein (NBP1-86460PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYOM1 Products

Array NBP1-86460PEP

Blogs on MYOM1

There are no specific blogs for MYOM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYOM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOM1