MYL7 Antibody - Azide and BSA Free

Western Blot: MYL7 Antibody [H00058498-B01P] - Analysis of MYL7 expression in transfected 293T cell line by MYL7 polyclonal antibody. Lane 1: MYL7 transfected lysate(19.25 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MYL7 Antibody - Azide and BSA Free Summary

• Immunogen: MYL7 (NP_067046.1, 1 a.a. - 175 a.a.) full-length human protein. MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
• Specificity: MYL7 - myosin, light polypeptide 7, regulatory,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MYL7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYL7 Antibody - Azide and BSA Free

• atrial isoform
• light polypeptide 7, regulatory
• MLC-2a
• MYL2A
• MYLC2AMLC2a
• myosin, light chain 7, regulatory

Background

Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYL7
• Entrez:
  • 58498(Human)
• Uniprot:
  • NP_067046.1(Human)