MYL5 Antibody (1C5)

Images

 
Western Blot: MYL5 Antibody (1C5) [H00004636-M01] - Analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody (M01), clone 1C5.Lane 1: MYL5 transfected lysate(19.5 KDa).Lane 2: ...read more
Sandwich ELISA: MYL5 Antibody (1C5) [H00004636-M01] - Detection limit for recombinant GST tagged MYL5 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYL5 Antibody (1C5) Summary

Immunogen
MYL5 (AAH40050.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Specificity
MYL5 - myosin, light polypeptide 5, regulatory
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYL5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004636-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYL5 Antibody (1C5)

  • light polypeptide 5, regulatory
  • MYLC2
  • myLC-2
  • myosin light chain 5
  • Myosin regulatory light chain 5
  • myosin, light chain 5, regulatory
  • Superfast myosin regulatory light chain 2

Background

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-04686
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-62625
Species: Hu
Applications: IHC, IHC-P
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-1687
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
291-G1
Species: Hu
Applications: BA
6829-F6/CF
Species: Hu
Applications: BA

Publications for MYL5 Antibody (H00004636-M01)(1)

Reviews for MYL5 Antibody (H00004636-M01) (0)

There are no reviews for MYL5 Antibody (H00004636-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL5 Antibody (H00004636-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYL5 Products

Bioinformatics Tool for MYL5 Antibody (H00004636-M01)

Discover related pathways, diseases and genes to MYL5 Antibody (H00004636-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL5 Antibody (H00004636-M01)

Discover more about diseases related to MYL5 Antibody (H00004636-M01).
 

Pathways for MYL5 Antibody (H00004636-M01)

View related products by pathway.

PTMs for MYL5 Antibody (H00004636-M01)

Learn more about PTMs related to MYL5 Antibody (H00004636-M01).
 

Research Areas for MYL5 Antibody (H00004636-M01)

Find related products by research area.

Blogs on MYL5

There are no specific blogs for MYL5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL5 Antibody (1C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL5
Entrez
OMIM
Uniprot