MYL4 Antibody (1A11-C8)

Images

 
There are currently no images for MYL4 Antibody (H00004635-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A11-C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYL4 Antibody (1A11-C8) Summary

Immunogen
MYL4 (AAH30228, 1 a.a. - 197 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Specificity
MYL4 - myosin, light polypeptide 4, alkali; atrial, embryonic
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using
H00004635-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYL4 Antibody (1A11-C8)

  • ALC1
  • AMLC
  • GT1
  • MLC1
  • Myosin light chain 1, embryonic muscle/atrial isoform
  • myosin light chain 4
  • Myosin light chain alkali GT-1 isoform
  • myosin, atrial/fetal muscle, light chain
  • myosin, light chain 4, alkali; atrial, embryonic
  • myosin, light polypeptide 4, alkali; atrial, embryonic
  • PRO1957

Background

Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-02417
Species: Hu, Mu, Rt, Av, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35006
Species: Hu
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-16433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00004635-M01
Species: Hu
Applications: WB, ELISA

Publications for MYL4 Antibody (H00004635-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MYL4 Antibody (H00004635-M01) (0)

There are no reviews for MYL4 Antibody (H00004635-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL4 Antibody (H00004635-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYL4 Products

Bioinformatics Tool for MYL4 Antibody (H00004635-M01)

Discover related pathways, diseases and genes to MYL4 Antibody (H00004635-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL4 Antibody (H00004635-M01)

Discover more about diseases related to MYL4 Antibody (H00004635-M01).
 

Pathways for MYL4 Antibody (H00004635-M01)

View related products by pathway.

Blogs on MYL4

There are no specific blogs for MYL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL4 Antibody (1A11-C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL4
Entrez
OMIM
Uniprot