Recombinant Human MYF6 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MYF6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 242 of Human MYF6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MYF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
53.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MYF6 Protein

  • bHLHc4BHLHC4
  • Class C basic helix-loop-helix protein 4
  • MRF4
  • MRF4myogenic factor 6
  • Muscle-specific regulatory factor 4
  • myf-6
  • myogenic factor 6 (herculin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13957
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF6116
Species: Hu
Applications: WB, ICC
MAB7650
Species: Mu
Applications: WB, IHC
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MYF6 Recombinant Protein (H00004618-P01) (0)

There are no publications for MYF6 Recombinant Protein (H00004618-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYF6 Recombinant Protein (H00004618-P01) (0)

There are no reviews for MYF6 Recombinant Protein (H00004618-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYF6 Recombinant Protein (H00004618-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYF6 Products

Bioinformatics Tool for MYF6 Recombinant Protein (H00004618-P01)

Discover related pathways, diseases and genes to MYF6 Recombinant Protein (H00004618-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYF6 Recombinant Protein (H00004618-P01)

Discover more about diseases related to MYF6 Recombinant Protein (H00004618-P01).
 

Pathways for MYF6 Recombinant Protein (H00004618-P01)

View related products by pathway.

PTMs for MYF6 Recombinant Protein (H00004618-P01)

Learn more about PTMs related to MYF6 Recombinant Protein (H00004618-P01).

Blogs on MYF6

There are no specific blogs for MYF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MYF6 Antibody
NBP1-52030

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MYF6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYF6