MYEOV Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MYEOV Antibody [NBP1-80974] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: MYEOV Antibody [NBP1-80974] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYEOV Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGN
Specificity
Specificity of human MYEOV antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYEOV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYEOV Protein (NBP1-80974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYEOV Antibody

  • myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
  • myeloma overexpressed gene (in a subset of t(11;14) positive multiple myelomas)
  • OCIMhypothetical protein LOC26579
  • Oncogene in multiple myeloma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-86923
Species: Hu
Applications: IHC, IHC-P
AF7035
Species: Hu
Applications: IHC
MAB6978
Species: Hu, Mu, Rt
Applications: WB
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5394
Species: Hu, Mu
Applications: WB
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA, IHC-P
NBP1-90105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80974
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MYEOV Antibody (NBP1-80974) (0)

There are no publications for MYEOV Antibody (NBP1-80974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYEOV Antibody (NBP1-80974) (0)

There are no reviews for MYEOV Antibody (NBP1-80974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MYEOV Antibody (NBP1-80974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-80974

Bioinformatics Tool for MYEOV Antibody (NBP1-80974)

Discover related pathways, diseases and genes to MYEOV Antibody (NBP1-80974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYEOV Antibody (NBP1-80974)

Discover more about diseases related to MYEOV Antibody (NBP1-80974).
 

Pathways for MYEOV Antibody (NBP1-80974)

View related products by pathway.

PTMs for MYEOV Antibody (NBP1-80974)

Learn more about PTMs related to MYEOV Antibody (NBP1-80974).

Blogs on MYEOV

There are no specific blogs for MYEOV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYEOV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYEOV