MYD118 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MYD118 Antibody [NBP1-87990] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MYD118 Antibody [NBP1-87990] - Staining of human skeletal muscle shows weak positivity in a subset of myocytes.

Immunohistochemistry-Paraffin: MYD118 Antibody [NBP1-87990] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MYD118 Antibody [NBP1-87990] - Staining of human lymph node shows moderate cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: MYD118 Antibody [NBP1-87990] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYD118 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GADD45B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 24708576). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MYD118 Protein (NBP1-87990PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24708576).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYD118 Antibody - BSA Free

• DKFZp566B133
• GADD45BETA
• growth arrest and DNA damage-inducible protein GADD45 beta
• growth arrest and DNA-damage-inducible, beta
• MYD118DKFZP566B133
• Myeloid differentiation primary response protein MyD118
• Negative growth regulatory protein MyD118

Background

GADD45B is a member of GADD45 family (GADD45®, ®, and ®) that are nuclear proteins to interact with various proteins implicated in stress responses and cell-cycle-related proteins. The function of GADD45 proteins is involved in growth-regulatory mechanisms and apoptosis. GADD45B is necessary for adult neurogenesis, including brain-derived neurotrophic factor and fibroblast growth factor. And therefore, this protein is implicated in affecting synaptic plasticity. Recombinant GADD45B protein was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MYD118 Antibody (NBP1-87990)(1)

Publication using NBP1-87990

• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: GADD45B