MVP Antibody


Orthogonal Strategies: Western Blot: MVP Antibody [NBP2-56408] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining in human small intestine and pancreas tissues using anti-MVP antibody. Corresponding MVP RNA-seq data are presented for more
Immunohistochemistry: MVP Antibody [NBP2-56408] - Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human small intestine shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

MVP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD
Specificity of human MVP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
MVP Knockout HeLa Cell Lysate
Control Peptide
MVP Recombinant Protein Antigen (NBP2-56408PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MVP Antibody

  • Lung resistance-related protein
  • major vault protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MVP Antibody (NBP2-56408) (0)

There are no publications for MVP Antibody (NBP2-56408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVP Antibody (NBP2-56408) (0)

There are no reviews for MVP Antibody (NBP2-56408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MVP Antibody (NBP2-56408). (Showing 1 - 1 of 1 FAQ).

  1. Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?
    • At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MVP Products

Bioinformatics Tool for MVP Antibody (NBP2-56408)

Discover related pathways, diseases and genes to MVP Antibody (NBP2-56408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVP Antibody (NBP2-56408)

Discover more about diseases related to MVP Antibody (NBP2-56408).

Pathways for MVP Antibody (NBP2-56408)

View related products by pathway.

PTMs for MVP Antibody (NBP2-56408)

Learn more about PTMs related to MVP Antibody (NBP2-56408).

Research Areas for MVP Antibody (NBP2-56408)

Find related products by research area.

Blogs on MVP

There are no specific blogs for MVP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MVP Antibody and receive a gift card or discount.


Gene Symbol MVP