MVP Antibody

Images

 
Western Blot: MVP Antibody [NBP2-56408] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining in human small intestine and pancreas tissues using anti-MVP antibody. Corresponding MVP RNA-seq data are presented for the same tissues.
Western Blot: MVP Antibody [NBP2-56408] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry: MVP Antibody [NBP2-56408] - Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MVP Antibody [NBP2-56408] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MVP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD
Specificity
Specificity of human MVP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MVP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
MVP Lysate (NBP2-64680)
Control Peptide
MVP Recombinant Protein Antigen (NBP2-56408PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MVP Antibody

  • LRPVAULT1
  • Lung resistance-related protein
  • major vault protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-556
Species: Hu
Applications: WB, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56408
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MVP Antibody (NBP2-56408) (0)

There are no publications for MVP Antibody (NBP2-56408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MVP Antibody (NBP2-56408) (0)

There are no reviews for MVP Antibody (NBP2-56408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MVP Antibody (NBP2-56408). (Showing 1 - 1 of 1 FAQ).

  1. Are there any MVP antibodies that will recognize mouse and can be used for immunofluorescence?
    • At this time we do not have an MVP antibody that will recognize mouse and has been used for immunofluorescence. If you would like to try an antibody in an untested species or application you would qualify for our Innovator's Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MVP Antibody (NBP2-56408)

Discover related pathways, diseases and genes to MVP Antibody (NBP2-56408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MVP Antibody (NBP2-56408)

Discover more about diseases related to MVP Antibody (NBP2-56408).
 

Pathways for MVP Antibody (NBP2-56408)

View related products by pathway.

PTMs for MVP Antibody (NBP2-56408)

Learn more about PTMs related to MVP Antibody (NBP2-56408).
 

Research Areas for MVP Antibody (NBP2-56408)

Find related products by research area.

Blogs on MVP

There are no specific blogs for MVP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MVP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MVP