Recombinant Human Muscleblind-like 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Muscleblind-like 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 382 of Human MBNL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MBNL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. Use in Mouse reported in customer review.
Reviewed Applications
Read 1 Review rated 5
using
H00004154-P02 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Muscleblind-like 1 Protein

  • DKFZp686P06174
  • EXP40
  • EXP42
  • EXPKIAA0428EXP35
  • MBNL
  • muscleblind (Drosophila)-like
  • muscleblind-like (Drosophila)
  • muscleblind-like protein 1
  • Triplet-expansion RNA-binding protein

Background

MBNL1( AAH43493, 1 a.a. - 383 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-79451
Species: Hu
Applications: WB
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut

Publications for Muscleblind-like 1 Recombinant Protein (H00004154-P02) (0)

There are no publications for Muscleblind-like 1 Recombinant Protein (H00004154-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Muscleblind-like 1 Recombinant Protein (H00004154-P02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using H00004154-P02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
arti modi
WB Mouse 05/12/2010
View

Summary

ApplicationWestern Blot
Sample TestedMuscleblind-like 1 Recombinant Protein
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscleblind-like 1 Recombinant Protein (H00004154-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Muscleblind-like 1 Products

Bioinformatics Tool for Muscleblind-like 1 Recombinant Protein (H00004154-P02)

Discover related pathways, diseases and genes to Muscleblind-like 1 Recombinant Protein (H00004154-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscleblind-like 1 Recombinant Protein (H00004154-P02)

Discover more about diseases related to Muscleblind-like 1 Recombinant Protein (H00004154-P02).
 

Pathways for Muscleblind-like 1 Recombinant Protein (H00004154-P02)

View related products by pathway.

PTMs for Muscleblind-like 1 Recombinant Protein (H00004154-P02)

Learn more about PTMs related to Muscleblind-like 1 Recombinant Protein (H00004154-P02).

Blogs on Muscleblind-like 1

There are no specific blogs for Muscleblind-like 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
arti modi
05/12/2010
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol MBNL1